(data stored in ACNUC7421 zone)

EMBL: CP001630.PE74

CP001630.PE74        Location/Qualifiers
FT   CDS             82815..83162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0074"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: rfr:Rfer_3913 rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34048"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ3"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACU34048.1"
FT                   /translation="MSRVTVPSVEVSDVPAELPEGAVLLDVREVDEWAAGHAPGAVHIP
FT                   MSELAGRLGEVPEADVVYVVCRMGGRSARVTEYLNANGWDAVNVDGGMQTWSTQGRPMV
FT                   GELPDVEPEVI"
     MSRVTVPSVE VSDVPAELPE GAVLLDVREV DEWAAGHAPG AVHIPMSELA GRLGEVPEAD        60
     VVYVVCRMGG RSARVTEYLN ANGWDAVNVD GGMQTWSTQG RPMVGELPDV EPEVI            115
//

If you have problems or comments...

PBIL Back to PBIL home page