(data stored in ACNUC7421 zone)

EMBL: CP001630.PE75

CP001630.PE75        Location/Qualifiers
FT   CDS             83164..84072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34049"
FT                   /db_xref="GOA:C6WDQ4"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34049.1"
FT                   /translation="MRPLQPMRVDWVATPPPGAYPARRFGGARRPYAGPPSYPVPPRWG
FT                   FPLLAWRWPTSVALDEARPLDRVDQVQRLARTASQALGLAGMTALWAAGSELWRYALLL
FT                   LSRTGALSATTVGVSDAMVVAASAVAGITSAIALVLSFLWVRAARAAAAAASGYAPSRS
FT                   ERELVLGLVVPGVNLVVPGSALAELEHAALRLPVDARPKPSKLLLRWWALWVVSALFFA
FT                   LTVAWSFRSSVQALADGVFLHAVSDLLAAGVALTTAVVVRRLTTLLLPLDPASLRRMRV
FT                   VGVKGAPAPELRAIRASGSPR"
     MRPLQPMRVD WVATPPPGAY PARRFGGARR PYAGPPSYPV PPRWGFPLLA WRWPTSVALD        60
     EARPLDRVDQ VQRLARTASQ ALGLAGMTAL WAAGSELWRY ALLLLSRTGA LSATTVGVSD       120
     AMVVAASAVA GITSAIALVL SFLWVRAARA AAAAASGYAP SRSERELVLG LVVPGVNLVV       180
     PGSALAELEH AALRLPVDAR PKPSKLLLRW WALWVVSALF FALTVAWSFR SSVQALADGV       240
     FLHAVSDLLA AGVALTTAVV VRRLTTLLLP LDPASLRRMR VVGVKGAPAP ELRAIRASGS       300
     PR                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page