(data stored in ACNUC7421 zone)

EMBL: CP001630.PE76

CP001630.PE76        Location/Qualifiers
FT   CDS             84163..85212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0076"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34050"
FT                   /db_xref="GOA:C6WDQ5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ5"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACU34050.1"
FT                   /translation="MRALGAALVVMLLLPGAASAGAGTGAGHGHGHGHGKHGFDLQAHR
FT                   GGIGLTVESTLAAFAKALEVGVTTLELDVQITRDGREVVTHDRRTNPAKCVDTAPARPG
FT                   DPEFPYAGKYVKDLDFAQVRTLDCGSRRSAQHPDQELSPGARMPTLAEVFALARRYRAH
FT                   DVRFNVETKVEAAAPHETAPREQFVDVTWREIRRSGFERDVTIQSFDWGTLMLWRKVAP
FT                   RLPVIALTQPEFLAPGSPWTGGLDLADFGGSPARAARSFGASALSPVHGNPQNGKVGDP
FT                   DYVPFTTEALVEDAHRNGLEVIPWTVNDPATMRKLIRDGVDGLITDYPDRLRAVLEDLG
FT                   YRLPQRYHR"
     MRALGAALVV MLLLPGAASA GAGTGAGHGH GHGHGKHGFD LQAHRGGIGL TVESTLAAFA        60
     KALEVGVTTL ELDVQITRDG REVVTHDRRT NPAKCVDTAP ARPGDPEFPY AGKYVKDLDF       120
     AQVRTLDCGS RRSAQHPDQE LSPGARMPTL AEVFALARRY RAHDVRFNVE TKVEAAAPHE       180
     TAPREQFVDV TWREIRRSGF ERDVTIQSFD WGTLMLWRKV APRLPVIALT QPEFLAPGSP       240
     WTGGLDLADF GGSPARAARS FGASALSPVH GNPQNGKVGD PDYVPFTTEA LVEDAHRNGL       300
     EVIPWTVNDP ATMRKLIRDG VDGLITDYPD RLRAVLEDLG YRLPQRYHR                   349
//

If you have problems or comments...

PBIL Back to PBIL home page