(data stored in ACNUC7421 zone)

EMBL: CP001630.PE77

CP001630.PE77        Location/Qualifiers
FT   CDS             complement(85244..86476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0077"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: jan:Jann_1726
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34051"
FT                   /db_xref="GOA:C6WDQ6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ6"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACU34051.1"
FT                   /translation="MDASGPQDLPSGVVAPFDQNDPSFIADPYPVFAALRVQGEVHWHD
FT                   GMGLAVAVSHAASSAVLRHRSLGRLWTDAKPLEEFASFNLLHRNSLLENEGATHARLRR
FT                   LVSAAFGRGHVERLRPRIAELADGLVDGLVDRVRADGSADLLEHVAGPLPVEVIAELLG
FT                   VPHSERSLLQPWSNAIVKMYEHGLAEDKRAAAERAAREFVAYLREVVALRRRQPGDDLV
FT                   SDLVAVTDSDGARLSEDELVATAVLLLMAGHEATVNVIGNGVLALVEHRDQWERLVADP
FT                   GLLETAVEELIRYDSPLQLFERTATKREEIAGHVVEEGAKIAALLGAAARDPEVFERPD
FT                   EFDVGRTPNQHLGFGMGIHYCLGAPLARIEVQAAVDALRRKLPGMELAATPRRREEFVI
FT                   RGLHELPLGAG"
     MDASGPQDLP SGVVAPFDQN DPSFIADPYP VFAALRVQGE VHWHDGMGLA VAVSHAASSA        60
     VLRHRSLGRL WTDAKPLEEF ASFNLLHRNS LLENEGATHA RLRRLVSAAF GRGHVERLRP       120
     RIAELADGLV DGLVDRVRAD GSADLLEHVA GPLPVEVIAE LLGVPHSERS LLQPWSNAIV       180
     KMYEHGLAED KRAAAERAAR EFVAYLREVV ALRRRQPGDD LVSDLVAVTD SDGARLSEDE       240
     LVATAVLLLM AGHEATVNVI GNGVLALVEH RDQWERLVAD PGLLETAVEE LIRYDSPLQL       300
     FERTATKREE IAGHVVEEGA KIAALLGAAA RDPEVFERPD EFDVGRTPNQ HLGFGMGIHY       360
     CLGAPLARIE VQAAVDALRR KLPGMELAAT PRRREEFVIR GLHELPLGAG                  410
//

If you have problems or comments...

PBIL Back to PBIL home page