(data stored in ACNUC7421 zone)

EMBL: CP001630.PE78

CP001630.PE78        Location/Qualifiers
FT   CDS             86596..87294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0078"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: gbm:Gbem_3150 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34052"
FT                   /db_xref="GOA:C6WDQ7"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ7"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACU34052.1"
FT                   /translation="MSPEVVAHRGASAALPEHTLAAYELAIAEGADALECDVRLTRDEQ
FT                   LVCVHDRTVSRTSDGRGAVGALTLAELRALDFGSWHGGDPAPVLTFAELAGLAADHGTP
FT                   LFVETKHPVRTGGLVETRLAQELARHSLDVHMMSFSALAVRRFKALAPAVPTVWLLDRL
FT                   WPQRLPEWADLPGPGVSLLRRSPGRGRGAYCWTVDTAPDIDLCRERGVRHLATNHPART
FT                   RKILAADLAP"
     MSPEVVAHRG ASAALPEHTL AAYELAIAEG ADALECDVRL TRDEQLVCVH DRTVSRTSDG        60
     RGAVGALTLA ELRALDFGSW HGGDPAPVLT FAELAGLAAD HGTPLFVETK HPVRTGGLVE       120
     TRLAQELARH SLDVHMMSFS ALAVRRFKAL APAVPTVWLL DRLWPQRLPE WADLPGPGVS       180
     LLRRSPGRGR GAYCWTVDTA PDIDLCRERG VRHLATNHPA RTRKILAADL AP               232
//

If you have problems or comments...

PBIL Back to PBIL home page