(data stored in ACNUC7421 zone)

EMBL: CP001630.PE79

CP001630.PE79        Location/Qualifiers
FT   CDS             87313..88257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0079"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34053"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ8"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACU34053.1"
FT                   /translation="MAKRTAVKSKSADGVNPRQPCPCGSGKRYKACHGGADGGADVIVA
FT                   RPFAGLASEAELIALREFVPSATVKLPLKDAPREVVLASVLPMAAAGLVRADGTAFVGL
FT                   QVQTRSGDLSRDLARAVQWAYTAETGDVLPVVGPEDGTNPGRLQDLLDVEASVSPELHA
FT                   DFAWWMPPGNEPAGDVALSLERANAAILPTERVDAPGVTAAYWVDAGDKAHLRWVRPEP
FT                   EEQLLAALARLSVRGELDLGDGTRYAGSFRAHGLLVPVWDLDRESHSSEWAGPAEALGK
FT                   RLLDALASLDSEPLSEAERRSRDGLRGRQITLR"
     MAKRTAVKSK SADGVNPRQP CPCGSGKRYK ACHGGADGGA DVIVARPFAG LASEAELIAL        60
     REFVPSATVK LPLKDAPREV VLASVLPMAA AGLVRADGTA FVGLQVQTRS GDLSRDLARA       120
     VQWAYTAETG DVLPVVGPED GTNPGRLQDL LDVEASVSPE LHADFAWWMP PGNEPAGDVA       180
     LSLERANAAI LPTERVDAPG VTAAYWVDAG DKAHLRWVRP EPEEQLLAAL ARLSVRGELD       240
     LGDGTRYAGS FRAHGLLVPV WDLDRESHSS EWAGPAEALG KRLLDALASL DSEPLSEAER       300
     RSRDGLRGRQ ITLR                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page