(data stored in ACNUC7421 zone)

EMBL: CP001630.PE8

CP001630.PE8         Location/Qualifiers
FT   CDS             11278..12144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33982"
FT                   /db_xref="GOA:C6WCG1"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33982.1"
FT                   /translation="MTPPEKEDRDADKTAVITRPSVEAAKAPEAAAASSGEPEKKPEEV
FT                   VTTAVPAAAPEAAKAPEKPAEKPVDESPTVAVTPPPWQRSTSEGGYSEAAQVGPGDDVK
FT                   PAEAGAPASPVFPSLDQDTVAVAKPVPPGAAPAAAAAAAAPRTAVNLGTQSRPQASSSA
FT                   RRPGRGPRRASLQVKRVDPWSVLKLALVLSVALFFVWLVAVGVLYGVLNGMGVWDKINN
FT                   TANDLLQSEEASGDPLISAGRVFGVSAIVGAVNIVLFTALATVGAFVYNVSADLAGGLE
FT                   VTLSERE"
     MTPPEKEDRD ADKTAVITRP SVEAAKAPEA AAASSGEPEK KPEEVVTTAV PAAAPEAAKA        60
     PEKPAEKPVD ESPTVAVTPP PWQRSTSEGG YSEAAQVGPG DDVKPAEAGA PASPVFPSLD       120
     QDTVAVAKPV PPGAAPAAAA AAAAPRTAVN LGTQSRPQAS SSARRPGRGP RRASLQVKRV       180
     DPWSVLKLAL VLSVALFFVW LVAVGVLYGV LNGMGVWDKI NNTANDLLQS EEASGDPLIS       240
     AGRVFGVSAI VGAVNIVLFT ALATVGAFVY NVSADLAGGL EVTLSERE                    288
//

If you have problems or comments...

PBIL Back to PBIL home page