(data stored in ACNUC7421 zone)

EMBL: CP001630.PE80

CP001630.PE80        Location/Qualifiers
FT   CDS             88330..88656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0080"
FT                   /product="protein of unknown function DUF952"
FT                   /note="PFAM: protein of unknown function DUF952; KEGG:
FT                   rru:Rru_A0513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34054"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ9"
FT                   /inference="protein motif:PFAM:PF06108"
FT                   /protein_id="ACU34054.1"
FT                   /translation="MLLRISTRADWAEARESGAIPLDLEGFVHCADPGTVHLPANSLYR
FT                   NRSGLVLLVVDPEGLPVLYEPGDGDESGPWFPHVYGPIPADSVVAVLDFEPDPDGVFRP
FT                   PPVL"
     MLLRISTRAD WAEARESGAI PLDLEGFVHC ADPGTVHLPA NSLYRNRSGL VLLVVDPEGL        60
     PVLYEPGDGD ESGPWFPHVY GPIPADSVVA VLDFEPDPDG VFRPPPVL                    108
//

If you have problems or comments...

PBIL Back to PBIL home page