(data stored in ACNUC7421 zone)

EMBL: CP001630.PE81

CP001630.PE81        Location/Qualifiers
FT   CDS             88777..89808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0081"
FT                   /product="Phenylacetaldoxime dehydratase"
FT                   /EC_number="4.99.1.7"
FT                   /note="KEGG: xau:Xaut_1560 phenylacetaldoxime dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34055"
FT                   /db_xref="GOA:C6WDR0"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR025702"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR0"
FT                   /inference="protein motif:PRIAM:4.99.1.7"
FT                   /protein_id="ACU34055.1"
FT                   /translation="MSSLPLDDRATAHRPEGYDPRGGPGHEVRWSDDVTHLVVARFGVQ
FT                   TDDSAAGVKAIARVLELAAGESGPALVERVSDDDSEMAVCYWPDPEAHRAWWASGPVRD
FT                   WWASLPVDGPIGHWHETSVTPVEQFETLYSAEFAAGPSRFAGTGPTNLHDYDNSTLDRM
FT                   PATAHRDLRQERAEEPTTDLPPGESPRGRRVRLAEPSPSGLCWIRTAQEWSIAPDDQLA
FT                   SYRDGVEPAYRTAIAHLQDNPHDTGCLSARLVGNLDANGARAAGAEAVVWWRGIGDLLR
FT                   WAHDHKTHQDILNGFWEHVIAKFGPGTRVRLWHEVHVLPEGALTAEYVNCHPGTGLLQT
FT                   WPG"
     MSSLPLDDRA TAHRPEGYDP RGGPGHEVRW SDDVTHLVVA RFGVQTDDSA AGVKAIARVL        60
     ELAAGESGPA LVERVSDDDS EMAVCYWPDP EAHRAWWASG PVRDWWASLP VDGPIGHWHE       120
     TSVTPVEQFE TLYSAEFAAG PSRFAGTGPT NLHDYDNSTL DRMPATAHRD LRQERAEEPT       180
     TDLPPGESPR GRRVRLAEPS PSGLCWIRTA QEWSIAPDDQ LASYRDGVEP AYRTAIAHLQ       240
     DNPHDTGCLS ARLVGNLDAN GARAAGAEAV VWWRGIGDLL RWAHDHKTHQ DILNGFWEHV       300
     IAKFGPGTRV RLWHEVHVLP EGALTAEYVN CHPGTGLLQT WPG                         343
//

If you have problems or comments...

PBIL Back to PBIL home page