(data stored in ACNUC7421 zone)

EMBL: CP001630.PE82

CP001630.PE82        Location/Qualifiers
FT   CDS             complement(89920..90483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0082"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34056"
FT                   /db_xref="GOA:C6WDR1"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR1"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACU34056.1"
FT                   /translation="MALNLKKLPTETSSKFRALLQEQIGNEFTASQQYTAIAVWYDSRD
FT                   LPRLAAHFYAQALEERNHAMMLVKYLLDTDVPVTIPGVGEVRNDFGSAREPVELALAQE
FT                   KTVTEQIVALAKAARDEGDYLGEQFLQWFLKEQVEEVSSMSTLLTVVDRADGNLFHVEN
FT                   FVARELSGAGGDDPTAPAAAGGAL"
     MALNLKKLPT ETSSKFRALL QEQIGNEFTA SQQYTAIAVW YDSRDLPRLA AHFYAQALEE        60
     RNHAMMLVKY LLDTDVPVTI PGVGEVRNDF GSAREPVELA LAQEKTVTEQ IVALAKAARD       120
     EGDYLGEQFL QWFLKEQVEE VSSMSTLLTV VDRADGNLFH VENFVARELS GAGGDDPTAP       180
     AAAGGAL                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page