(data stored in ACNUC7421 zone)

EMBL: CP001630.PE83

CP001630.PE83        Location/Qualifiers
FT   CDS             complement(90632..91879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0083"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="KEGG: ses:SARI_03184 arginine deiminase; TIGRFAM:
FT                   arginine deiminase; PFAM: amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34057"
FT                   /db_xref="GOA:C6WDR2"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR2"
FT                   /inference="protein motif:TFAM:TIGR01078"
FT                   /protein_id="ACU34057.1"
FT                   /translation="MTAHIEHTQSATPAPGPAPRVDSEVGPLRTVLLHRPGAELKRLTP
FT                   RNNDQLLFDGVPWVDRAQEEHDAFAGVLRSRGVEVLLLGDELVRALHDDRARIAGVHSA
FT                   VDERRLGIHLADALRSHLSGLAPEALATILTSGMTFEELPAAEGASLVRRMHQPGDFAV
FT                   DPLPNLLFTRDSSVWVGDRVAITSLAMPARGRETALTDLIYAYHPRFAKTGRAYGAHSA
FT                   PLEGGDVLLLAPGVLAIGVGERTTPAGAESFARSALADGLAHTVLAVPIAQQRATMHLD
FT                   TVCTMVDRDAVVMYPAVRDNLFAYPVRQDGSGGVRVSGPSPFLEAAAEAMGIDRLRVID
FT                   TGLDAVTAEREQWDDGNNTLAVGPGLVVAYERNVETNARLEEAGVEVLRISGSELGSGR
FT                   GGPRCMSCPIDRAPLV"
     MTAHIEHTQS ATPAPGPAPR VDSEVGPLRT VLLHRPGAEL KRLTPRNNDQ LLFDGVPWVD        60
     RAQEEHDAFA GVLRSRGVEV LLLGDELVRA LHDDRARIAG VHSAVDERRL GIHLADALRS       120
     HLSGLAPEAL ATILTSGMTF EELPAAEGAS LVRRMHQPGD FAVDPLPNLL FTRDSSVWVG       180
     DRVAITSLAM PARGRETALT DLIYAYHPRF AKTGRAYGAH SAPLEGGDVL LLAPGVLAIG       240
     VGERTTPAGA ESFARSALAD GLAHTVLAVP IAQQRATMHL DTVCTMVDRD AVVMYPAVRD       300
     NLFAYPVRQD GSGGVRVSGP SPFLEAAAEA MGIDRLRVID TGLDAVTAER EQWDDGNNTL       360
     AVGPGLVVAY ERNVETNARL EEAGVEVLRI SGSELGSGRG GPRCMSCPID RAPLV            415
//

If you have problems or comments...

PBIL Back to PBIL home page