(data stored in ACNUC7421 zone)

EMBL: CP001630.PE84

CP001630.PE84        Location/Qualifiers
FT   CDS             complement(92019..92672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34058"
FT                   /db_xref="GOA:C6WDR3"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="InterPro:IPR038261"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR3"
FT                   /inference="similar to AA sequence:KEGG:BH0832"
FT                   /protein_id="ACU34058.1"
FT                   /translation="MTTLADELVLICYSDEGRPSVTHPILGYGVTGALLTELVLAGRVD
FT                   LVDKKVVVTDPTPTGEPAVDALLARLAGADKPRKPQQWMHKLYKESTTQVLDGLVERGV
FT                   VRREEAKVLLVFPTTRYPTPDGRQPALEADARARLRAALEGDGPVDERTAALCALVGAA
FT                   RQERKVLPDVPKDRLKARLKEISQGAWASDAVRRAIDEIQVALVAGAAVAAAGA"
     MTTLADELVL ICYSDEGRPS VTHPILGYGV TGALLTELVL AGRVDLVDKK VVVTDPTPTG        60
     EPAVDALLAR LAGADKPRKP QQWMHKLYKE STTQVLDGLV ERGVVRREEA KVLLVFPTTR       120
     YPTPDGRQPA LEADARARLR AALEGDGPVD ERTAALCALV GAARQERKVL PDVPKDRLKA       180
     RLKEISQGAW ASDAVRRAID EIQVALVAGA AVAAAGA                                217
//

If you have problems or comments...

PBIL Back to PBIL home page