(data stored in ACNUC7421 zone)

EMBL: CP001630.PE85

CP001630.PE85        Location/Qualifiers
FT   CDS             complement(92746..93540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0085"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   dal:Dalk_0566 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34059"
FT                   /db_xref="GOA:C6WDR4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR4"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ACU34059.1"
FT                   /translation="MIDQTRGPGELGPERFTPDQRRGYQVELLLVFSVTLGLSGLRSLV
FT                   RLVDSLLRPVPLNQQTVAINVPQARFDLLDLIAQLLSVLQLSAWGGLGLYLLWRSGVTF
FT                   KAVGLDRARPVFDAWGSLGLAALIGIPGLAFYLVAWNLGLNLAVQPSTLDSWWSAITLT
FT                   LAAAGNAWAEEVLVVGFILTRLRQLGWKDNTSLVVAAVLRGSYHLYQGFGGFIGNVVMG
FT                   LVYGRFWQRTGRLWPLIGAHTLLDVVAFVGYSLLRDHLSWLP"
     MIDQTRGPGE LGPERFTPDQ RRGYQVELLL VFSVTLGLSG LRSLVRLVDS LLRPVPLNQQ        60
     TVAINVPQAR FDLLDLIAQL LSVLQLSAWG GLGLYLLWRS GVTFKAVGLD RARPVFDAWG       120
     SLGLAALIGI PGLAFYLVAW NLGLNLAVQP STLDSWWSAI TLTLAAAGNA WAEEVLVVGF       180
     ILTRLRQLGW KDNTSLVVAA VLRGSYHLYQ GFGGFIGNVV MGLVYGRFWQ RTGRLWPLIG       240
     AHTLLDVVAF VGYSLLRDHL SWLP                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page