(data stored in ACNUC7421 zone)

EMBL: CP001630.PE86

CP001630.PE86        Location/Qualifiers
FT   CDS             complement(93550..94308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34060"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34060.1"
FT                   /translation="MTEIRRPPAPHPAERARTIATRGGRAALLPPDGAEDRVVPELHHV
FT                   HACGEATLLLPDEHPLVARAALGEVTSMLEIADHAAVPLREPVRGLLWITGWLRALDGP
FT                   DAREACVEVAEERPDPRLLDVGHGLTALRLVPASLVVADAETTTSLRPEVFAQAEPDPF
FT                   CAHEDHWLRHLELSHRDVVGLLVQHLPEGLRGGHVRPLGLDRFGLRLRVELEDTDHDVR
FT                   IAFSRPVATPSELSSELRRLMGCPFLAQRR"
     MTEIRRPPAP HPAERARTIA TRGGRAALLP PDGAEDRVVP ELHHVHACGE ATLLLPDEHP        60
     LVARAALGEV TSMLEIADHA AVPLREPVRG LLWITGWLRA LDGPDAREAC VEVAEERPDP       120
     RLLDVGHGLT ALRLVPASLV VADAETTTSL RPEVFAQAEP DPFCAHEDHW LRHLELSHRD       180
     VVGLLVQHLP EGLRGGHVRP LGLDRFGLRL RVELEDTDHD VRIAFSRPVA TPSELSSELR       240
     RLMGCPFLAQ RR                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page