(data stored in ACNUC7421 zone)

EMBL: CP001630.PE87

CP001630.PE87        Location/Qualifiers
FT   CDS             94407..95036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34061"
FT                   /db_xref="GOA:C6WDR6"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34061.1"
FT                   /translation="MVVPNQPSTEGAAIDDRWTHHCLETASRRVFGWVVLGALAFTAQL
FT                   VLVLWSDVPSHVPFALLAFSLGSIAWGLVRRPSPAGAMREEPWRFARVHWSNGRLVVHG
FT                   EEKSSVLEVRGAGPLVRGRIGKHRRAWLVLPDRQGNTVVTFRGVPKLFPARVLRAPVRR
FT                   GTGKAAGSSGAAGAGSAKGVKAGRTRRGTTRRGAKERGTGRDRSQG"
     MVVPNQPSTE GAAIDDRWTH HCLETASRRV FGWVVLGALA FTAQLVLVLW SDVPSHVPFA        60
     LLAFSLGSIA WGLVRRPSPA GAMREEPWRF ARVHWSNGRL VVHGEEKSSV LEVRGAGPLV       120
     RGRIGKHRRA WLVLPDRQGN TVVTFRGVPK LFPARVLRAP VRRGTGKAAG SSGAAGAGSA       180
     KGVKAGRTRR GTTRRGAKER GTGRDRSQG                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page