(data stored in ACNUC7421 zone)

EMBL: CP001630.PE88

CP001630.PE88        Location/Qualifiers
FT   CDS             complement(95197..96399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0088"
FT                   /product="homogentisate 12-dioxygenase"
FT                   /note="PFAM: homogentisate 12-dioxygenase; KEGG:
FT                   bcz:BCZK0217 homogentisate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34062"
FT                   /db_xref="GOA:C6WDR7"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR7"
FT                   /inference="protein motif:PFAM:PF04209"
FT                   /protein_id="ACU34062.1"
FT                   /translation="MPYYRQVGDIPRKRHTQFRSPDGSLYAEELMGVEGFSADSALLYH
FT                   RHLPTAIVDAVTVPDTRGPLVPNLPLKPRHFRTEPLVGSDPGGPGGPGGAADAVTGRRV
FT                   LFGNADVVICFAAATEPSPLYRNAFGDELLYVQSGEGVVETIYGALVVESGDYVVLPTS
FT                   CTYRLAPRTPMRLLVLEATGHIGPPKRYLSARGQFLEHSPYCERDLRGPAEPLLVDGED
FT                   VDVLVRHRAGLTRMTYAAHPFDVVGWDGCLYPWVFNIGDFEPITGRVHQPPPVHQTFEG
FT                   PNFVVCSFVPRKVDYHPLAVPVPYNHANVDSDELMFYVGGDYEARKGSGIGLGSLSLHP
FT                   AGCAHGPQPGAVEASLGAESFDETAVMVDTFRPLELGEAALAGEDARYAWSWSRRGPDL
FT                   D"
     MPYYRQVGDI PRKRHTQFRS PDGSLYAEEL MGVEGFSADS ALLYHRHLPT AIVDAVTVPD        60
     TRGPLVPNLP LKPRHFRTEP LVGSDPGGPG GPGGAADAVT GRRVLFGNAD VVICFAAATE       120
     PSPLYRNAFG DELLYVQSGE GVVETIYGAL VVESGDYVVL PTSCTYRLAP RTPMRLLVLE       180
     ATGHIGPPKR YLSARGQFLE HSPYCERDLR GPAEPLLVDG EDVDVLVRHR AGLTRMTYAA       240
     HPFDVVGWDG CLYPWVFNIG DFEPITGRVH QPPPVHQTFE GPNFVVCSFV PRKVDYHPLA       300
     VPVPYNHANV DSDELMFYVG GDYEARKGSG IGLGSLSLHP AGCAHGPQPG AVEASLGAES       360
     FDETAVMVDT FRPLELGEAA LAGEDARYAW SWSRRGPDLD                             400
//

If you have problems or comments...

PBIL Back to PBIL home page