(data stored in ACNUC7421 zone)

EMBL: CP001630.PE89

CP001630.PE89        Location/Qualifiers
FT   CDS             96535..97335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_6517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34063.1"
FT                   /translation="MDDAALFPPGDATMADAVRGYLDSRSGDWAGPLNLFLCPASRLAE
FT                   LITELIKVKPVKPVALSLVIDTGLGGVPKAVSIVESRSELLALRMVEMPAPSDVDEVWL
FT                   ERVSEFVPEDVIRVVEPRRGGAEWLDGVRRVIEHGSWPKLRCGGMRKENFPSVDEVADF
FT                   LAVVSGGGVAFKATAGLHHAVRHEDPETGFTHHGFLNLLVATARSLSGGDVRAALSSTD
FT                   AEALTAEAKALSDQAAHAVRGVFASYGSCSLADPIRDLEELGLL"
     MDDAALFPPG DATMADAVRG YLDSRSGDWA GPLNLFLCPA SRLAELITEL IKVKPVKPVA        60
     LSLVIDTGLG GVPKAVSIVE SRSELLALRM VEMPAPSDVD EVWLERVSEF VPEDVIRVVE       120
     PRRGGAEWLD GVRRVIEHGS WPKLRCGGMR KENFPSVDEV ADFLAVVSGG GVAFKATAGL       180
     HHAVRHEDPE TGFTHHGFLN LLVATARSLS GGDVRAALSS TDAEALTAEA KALSDQAAHA       240
     VRGVFASYGS CSLADPIRDL EELGLL                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page