(data stored in ACNUC7421 zone)

EMBL: CP001630.PE90

CP001630.PE90        Location/Qualifiers
FT   CDS             97332..98516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0090"
FT                   /product="Fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; Domain of
FT                   unknown function DUF1969; KEGG: jan:Jann_1436
FT                   fumarylacetoacetate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34064"
FT                   /db_xref="GOA:C6WDR9"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR9"
FT                   /inference="protein motif:PRIAM:3.7.1.2"
FT                   /protein_id="ACU34064.1"
FT                   /translation="MSWIEDPAFGPDHPFGPQTLPYGVTPDGVAVRVGDRALPLRPLAG
FT                   SFGRLADLVSAPDLDPLLRAGRPAWSELRARLVDLVTAPTAPRGAALTDLGGEILPFTV
FT                   ADYVDFYSSRHHAENVGRIFRPDGDPLLPNWTHLPVGYHGRAGTVVVSGTPVVRPRGQR
FT                   RAEGGPVFEPSARLDVEAEVGFVCGGPPESRLTPDRAADHVLGVVLVNDWSARDVQAWE
FT                   YQPLGPFLAKSFATSASAWITPLEAFSAARVAPPALPNPVLPHLAEERPWGLDLTLEVE
FT                   WNGEVVSRPPFREMSWTFAQQLAHLSSNGAPVRPGDLIASGTVSGPGVDERGSFLELTW
FT                   NGRDPVVVAGAERSFLEDGDTVRITATAPGPDGSVVGLAEVVGAVLAAAPVQGR"
     MSWIEDPAFG PDHPFGPQTL PYGVTPDGVA VRVGDRALPL RPLAGSFGRL ADLVSAPDLD        60
     PLLRAGRPAW SELRARLVDL VTAPTAPRGA ALTDLGGEIL PFTVADYVDF YSSRHHAENV       120
     GRIFRPDGDP LLPNWTHLPV GYHGRAGTVV VSGTPVVRPR GQRRAEGGPV FEPSARLDVE       180
     AEVGFVCGGP PESRLTPDRA ADHVLGVVLV NDWSARDVQA WEYQPLGPFL AKSFATSASA       240
     WITPLEAFSA ARVAPPALPN PVLPHLAEER PWGLDLTLEV EWNGEVVSRP PFREMSWTFA       300
     QQLAHLSSNG APVRPGDLIA SGTVSGPGVD ERGSFLELTW NGRDPVVVAG AERSFLEDGD       360
     TVRITATAPG PDGSVVGLAE VVGAVLAAAP VQGR                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page