(data stored in ACNUC7421 zone)

EMBL: CP001630.PE91

CP001630.PE91        Location/Qualifiers
FT   CDS             98519..99178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0091"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; SMART: regulatory
FT                   protein IclR; KEGG: dac:Daci_0951 IclR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34065"
FT                   /db_xref="GOA:C6WDS0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS0"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACU34065.1"
FT                   /translation="MSRSPEAGRADQKESSLTLERGLALLQAVADAESDAPTISELATA
FT                   IGASRAAVYRLLVPLQARGLVRREGSKVRLGLGVLRLAANVLPQLRIAAQPALRELAEA
FT                   VGATAHLTVADGAEAQAVAVVEPSWTAFHVAYRVGSRHPAHRGAAGRAIGLSTEGAQWT
FT                   VSSGELQHGAFGVAAPVRGVHGLRASVGVVSLDELVGDRVGPQVVAAAQQVADALR"
     MSRSPEAGRA DQKESSLTLE RGLALLQAVA DAESDAPTIS ELATAIGASR AAVYRLLVPL        60
     QARGLVRREG SKVRLGLGVL RLAANVLPQL RIAAQPALRE LAEAVGATAH LTVADGAEAQ       120
     AVAVVEPSWT AFHVAYRVGS RHPAHRGAAG RAIGLSTEGA QWTVSSGELQ HGAFGVAAPV       180
     RGVHGLRASV GVVSLDELVG DRVGPQVVAA AQQVADALR                              219
//

If you have problems or comments...

PBIL Back to PBIL home page