(data stored in ACNUC7421 zone)

EMBL: CP001630.PE92

CP001630.PE92        Location/Qualifiers
FT   CDS             99260..100771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0092"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bsu:BSU38760 cytochrome bd ubiquinol oxidase (subunit
FT                   I)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34066"
FT                   /db_xref="GOA:C6WDS1"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS1"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ACU34066.1"
FT                   /translation="MNVLDLSRWQFGITTVYHFLMVPLTIGLSLLVAAMQTAWVRTGDR
FT                   KYLAMTKFWGKLLLINFAMGVVTGIVQEFQFGMNWSAYSRFVGDVFGAPLAMEGLAAFF
FT                   VESTFLGLWIFGWDRLSKKAHLACAWAFSLATMLSAYFILAANSWMQHPVGTIISDEGR
FT                   PQLVSIGEVLTNNTTLAAFPHVIFGAFAVAAAFLVGIACWHLWKRSDEEPVWRASVKLG
FT                   AWVGIVSFVGLAITGDFQGKLMFQQQPMKMAAAEALCHTEEPAAFSIFAVGDVSRADCE
FT                   SVKSVTVPALLSFLAHNDFSSEVKGVQDLVTEYQAKYGENYPVDERLGELSGQPIDYVP
FT                   MLPVTYWGFRLMIGFGAISALVGAVALWLVRGGRQAPTGKWFPRLMLLSIATPFLGNSF
FT                   GWIFTEMGRQPFVVAPNPTGVDGVWMFTASAVSANTVGEVLTSVTVLTLLYGALAVVEG
FT                   FLLKKYVAGGVAGVMPPVKAPTGDGKDKDSDDKSDDDDDVLAFAY"
     MNVLDLSRWQ FGITTVYHFL MVPLTIGLSL LVAAMQTAWV RTGDRKYLAM TKFWGKLLLI        60
     NFAMGVVTGI VQEFQFGMNW SAYSRFVGDV FGAPLAMEGL AAFFVESTFL GLWIFGWDRL       120
     SKKAHLACAW AFSLATMLSA YFILAANSWM QHPVGTIISD EGRPQLVSIG EVLTNNTTLA       180
     AFPHVIFGAF AVAAAFLVGI ACWHLWKRSD EEPVWRASVK LGAWVGIVSF VGLAITGDFQ       240
     GKLMFQQQPM KMAAAEALCH TEEPAAFSIF AVGDVSRADC ESVKSVTVPA LLSFLAHNDF       300
     SSEVKGVQDL VTEYQAKYGE NYPVDERLGE LSGQPIDYVP MLPVTYWGFR LMIGFGAISA       360
     LVGAVALWLV RGGRQAPTGK WFPRLMLLSI ATPFLGNSFG WIFTEMGRQP FVVAPNPTGV       420
     DGVWMFTASA VSANTVGEVL TSVTVLTLLY GALAVVEGFL LKKYVAGGVA GVMPPVKAPT       480
     GDGKDKDSDD KSDDDDDVLA FAY                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page