(data stored in ACNUC7421 zone)

EMBL: CP001630.PE93

CP001630.PE93        Location/Qualifiers
FT   CDS             100786..101790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0093"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: glo:Glov_1209 cytochrome d ubiquinol oxidase,
FT                   subunit II; TIGRFAM: cytochrome d ubiquinol oxidase,
FT                   subunit II; PFAM: cytochrome bd ubiquinol oxidase subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34067"
FT                   /db_xref="GOA:C6WDS2"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS2"
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /protein_id="ACU34067.1"
FT                   /translation="METFWFCVIALFWLGFLFLEGFDFGVGMLLPVLGKDNTERRVMIN
FT                   TIGPVWDGNEVWLIVAGAATFAAFPLWYASLFSTAFLALLLFLVALIGRGVAFEYRGKV
FT                   DSERWRKNWDRVIISTSWVASFGIGFVLTTNVHGLPIDEIGDRVGGPFSYLTWQGIVGG
FT                   LAVSGFSLVHGALFTALKTEGEIRERARALVLKMAPVALLPLVVTLLLVQFEFGGPATW
FT                   GATVVVLLAAVGSLARLWAGREGQAFALMGVAVVATVIALFGAMYPNVLPSTVDPAFSL
FT                   TIENASSSSYTLTVMTWVSAFGAPAVLVYQGWTYWVFRKRIGVKNIPPVHVPS"
     METFWFCVIA LFWLGFLFLE GFDFGVGMLL PVLGKDNTER RVMINTIGPV WDGNEVWLIV        60
     AGAATFAAFP LWYASLFSTA FLALLLFLVA LIGRGVAFEY RGKVDSERWR KNWDRVIIST       120
     SWVASFGIGF VLTTNVHGLP IDEIGDRVGG PFSYLTWQGI VGGLAVSGFS LVHGALFTAL       180
     KTEGEIRERA RALVLKMAPV ALLPLVVTLL LVQFEFGGPA TWGATVVVLL AAVGSLARLW       240
     AGREGQAFAL MGVAVVATVI ALFGAMYPNV LPSTVDPAFS LTIENASSSS YTLTVMTWVS       300
     AFGAPAVLVY QGWTYWVFRK RIGVKNIPPV HVPS                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page