(data stored in ACNUC7421 zone)

EMBL: CP001630.PE94

CP001630.PE94        Location/Qualifiers
FT   CDS             complement(102023..103051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0094"
FT                   /product="TIR protein"
FT                   /note="SMART: TIR protein; KEGG: vvy:VV1926 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34068"
FT                   /db_xref="GOA:C6WDS3"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS3"
FT                   /inference="protein motif:SMART:SM00255"
FT                   /protein_id="ACU34068.1"
FT                   /translation="MRKTRRTGGLTCGVPPSEESPIRVFLSYAQDDDHVLGFIGPFTRA
FT                   LEQFAFSDRGRRVEVFVDRTDLVWGQEWRSGIDQAIDSAPVFLPLITNLYFDRPYCRKE
FT                   LHRFHSEADRRGVPSLLLPVVLLGHRMLTPDHEDPLVRVISERQYRDLREAMLEGSGSA
FT                   VWRRAVLALAGDLVDVVEEAERVLATAPPAPSADEDPLLGAFRERHRAVGALLAEVRTA
FT                   LSAELVAVERASVRPSVEAQRTALGVASALRVLGERFSDGCRDYEAAVAGALAPERRAG
FT                   AAALADEVAALWADERAVSDLLDRFRPLEEEYAPLRHTLRTLRRGCKSLQTALLLVERG
FT                   AG"
     MRKTRRTGGL TCGVPPSEES PIRVFLSYAQ DDDHVLGFIG PFTRALEQFA FSDRGRRVEV        60
     FVDRTDLVWG QEWRSGIDQA IDSAPVFLPL ITNLYFDRPY CRKELHRFHS EADRRGVPSL       120
     LLPVVLLGHR MLTPDHEDPL VRVISERQYR DLREAMLEGS GSAVWRRAVL ALAGDLVDVV       180
     EEAERVLATA PPAPSADEDP LLGAFRERHR AVGALLAEVR TALSAELVAV ERASVRPSVE       240
     AQRTALGVAS ALRVLGERFS DGCRDYEAAV AGALAPERRA GAAALADEVA ALWADERAVS       300
     DLLDRFRPLE EEYAPLRHTL RTLRRGCKSL QTALLLVERG AG                          342
//

If you have problems or comments...

PBIL Back to PBIL home page