(data stored in ACNUC7421 zone)

EMBL: CP001630.PE95

CP001630.PE95        Location/Qualifiers
FT   CDS             103158..106223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0095"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="KEGG: bpt:Bpet3362 HlyB/MsbA family ABC transporter;
FT                   TIGRFAM: ABC transporter, CydDC cysteine exporter (CydDC-E)
FT                   family, permease/ATP-binding protein CydD; ABC transporter,
FT                   CydDC cysteine exporter (CydDC-E) family,
FT                   permease/ATP-binding protein CydC; PFAM: ABC transporter
FT                   related; ABC transporter transmembrane region; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34069"
FT                   /db_xref="GOA:C6WDS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS4"
FT                   /inference="protein motif:TFAM:TIGR02857"
FT                   /protein_id="ACU34069.1"
FT                   /translation="MSFPGDLPARKKPGRGPLGALPKLSGSARRALVLCAFLAACTAVA
FT                   LVAQAVTLGTALADLVAGGSPLLWPIAATVLARALLAWATESAAARAAAGAKEELRAAL
FT                   LDRSLANGPEWITGRGPAELTALATKGLDALDAYFTRYLPALVTTAVVPPAVGLWILIS
FT                   DPTSAVLIAITIPLIPMFAILIGKFTEQKVAAVATTTEKLSARLHELVRALPVLTAFGR
FT                   AQAQAEAVRRTGDAHRRATMGTLRVAFLSALVLEIAASLSVALIAVGIGVRLVYGDMSL
FT                   ATGLIVLILAPDCYLPLRNAGAAHHASEDGLEAVRRVAEVVDSPRAEVTVPEAGETGVE
FT                   VRDLRVERRGGFAPDGLSFTVRPGQVHHLDAPSGRGKSTTIAALLGFLAPTSGEVRVRG
FT                   SVAWVPQRPAFAARTVAEELELTTGRVDHEVLRRVAAEHLVDRPVAELSTGERQRVAVA
FT                   RALSTGADVLLLDEPTAHLDPATAAKVMAAITAAAEGGAAVVLATHRLAEAADTDDDTT
FT                   AVRAADREPTTPRTPRPTRLLLGGAAIGTAALLSGVALTALSAYLIAKASTQPPILTLS
FT                   VITVGVRACALAKGVLRYLERLVTHDAAFRFADALRIDMWRNLRPGRAELTRLVDDTDT
FT                   VRDLVPRVLQPPLAAAGVGLAAVVLLTAIQPVAGLALAVLLLVGGLAAPLLAAALDRRA
FT                   TTALARGRRRVSEDVLTLLTAAPDLIAFRAEGRYRAGLAAVDAELARQTRRQAFGAGAA
FT                   TGLITLATGLAAVVCTALAGDVNPLLVPVLGLVPLALVETLSTLPAAAQHRAALREAYG
FT                   RVTERHPEVRPGTGPAKLENVDVRWPGAAEPVLRDFTLTPGVGERIAVVGPSGAGKSTL
FT                   FALLLGFLEPERGRVSRPERVAWCPQEPMLVSTTLRENLKLGDAHADDDRLREALVTAG
FT                   LPEWVDRLDTMIGPTLLSGGEAQRVALARALLHDADLVLLDEPTAHLDRPTAEALLDRL
FT                   DVALKGKTVVHITHRPEETRHADLVLSMRPAR"
     MSFPGDLPAR KKPGRGPLGA LPKLSGSARR ALVLCAFLAA CTAVALVAQA VTLGTALADL        60
     VAGGSPLLWP IAATVLARAL LAWATESAAA RAAAGAKEEL RAALLDRSLA NGPEWITGRG       120
     PAELTALATK GLDALDAYFT RYLPALVTTA VVPPAVGLWI LISDPTSAVL IAITIPLIPM       180
     FAILIGKFTE QKVAAVATTT EKLSARLHEL VRALPVLTAF GRAQAQAEAV RRTGDAHRRA       240
     TMGTLRVAFL SALVLEIAAS LSVALIAVGI GVRLVYGDMS LATGLIVLIL APDCYLPLRN       300
     AGAAHHASED GLEAVRRVAE VVDSPRAEVT VPEAGETGVE VRDLRVERRG GFAPDGLSFT       360
     VRPGQVHHLD APSGRGKSTT IAALLGFLAP TSGEVRVRGS VAWVPQRPAF AARTVAEELE       420
     LTTGRVDHEV LRRVAAEHLV DRPVAELSTG ERQRVAVARA LSTGADVLLL DEPTAHLDPA       480
     TAAKVMAAIT AAAEGGAAVV LATHRLAEAA DTDDDTTAVR AADREPTTPR TPRPTRLLLG       540
     GAAIGTAALL SGVALTALSA YLIAKASTQP PILTLSVITV GVRACALAKG VLRYLERLVT       600
     HDAAFRFADA LRIDMWRNLR PGRAELTRLV DDTDTVRDLV PRVLQPPLAA AGVGLAAVVL       660
     LTAIQPVAGL ALAVLLLVGG LAAPLLAAAL DRRATTALAR GRRRVSEDVL TLLTAAPDLI       720
     AFRAEGRYRA GLAAVDAELA RQTRRQAFGA GAATGLITLA TGLAAVVCTA LAGDVNPLLV       780
     PVLGLVPLAL VETLSTLPAA AQHRAALREA YGRVTERHPE VRPGTGPAKL ENVDVRWPGA       840
     AEPVLRDFTL TPGVGERIAV VGPSGAGKST LFALLLGFLE PERGRVSRPE RVAWCPQEPM       900
     LVSTTLRENL KLGDAHADDD RLREALVTAG LPEWVDRLDT MIGPTLLSGG EAQRVALARA       960
     LLHDADLVLL DEPTAHLDRP TAEALLDRLD VALKGKTVVH ITHRPEETRH ADLVLSMRPA      1020
     R                                                                      1021
//

If you have problems or comments...

PBIL Back to PBIL home page