(data stored in ACNUC7421 zone)

EMBL: CP001630.PE96

CP001630.PE96        Location/Qualifiers
FT   CDS             106220..107338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0096"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerization and phosphoacceptor region;
FT                   GAF domain protein; SMART: GAF domain protein; ATP-binding
FT                   region ATPase domain protein; KEGG: pna:Pnap_3765
FT                   multi-sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34070"
FT                   /db_xref="GOA:C6WDS5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34070.1"
FT                   /translation="MTAVDPARVLAASTEITSLALEGDDPDAVLPLVVRHAAELAGADL
FT                   GLSMISADDGTLTVEASSAGPEPVGIVVSSRSSAARAARTGIPVVAADLVSDPRTAPFV
FT                   PKPLRGYGPFAVAPFGTKERRIGALAVYRRRGSAPFSPDTVDVLTAFAAHAGLAVVLAE
FT                   GTTARQRVAVYQERERIARDLHDVVIQRLFATGVQLDLLDRKLKLEGREAKRLADAVDQ
FT                   LDETIAEVRATVRALRGTMPEQLAHTDLVDSVRSEARTAGELLGFRPDVRIVGHFLDLA
FT                   PALADQARAALREALANVVRHAGAGWVGITVDKDAERLALEVSDDGCGIPDGVEKRGLR
FT                   HLEERALAMGGGCEISSSPSTGTTIRWHVPLA"
     MTAVDPARVL AASTEITSLA LEGDDPDAVL PLVVRHAAEL AGADLGLSMI SADDGTLTVE        60
     ASSAGPEPVG IVVSSRSSAA RAARTGIPVV AADLVSDPRT APFVPKPLRG YGPFAVAPFG       120
     TKERRIGALA VYRRRGSAPF SPDTVDVLTA FAAHAGLAVV LAEGTTARQR VAVYQERERI       180
     ARDLHDVVIQ RLFATGVQLD LLDRKLKLEG REAKRLADAV DQLDETIAEV RATVRALRGT       240
     MPEQLAHTDL VDSVRSEART AGELLGFRPD VRIVGHFLDL APALADQARA ALREALANVV       300
     RHAGAGWVGI TVDKDAERLA LEVSDDGCGI PDGVEKRGLR HLEERALAMG GGCEISSSPS       360
     TGTTIRWHVP LA                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page