(data stored in ACNUC7421 zone)

EMBL: CP001630.PE97

CP001630.PE97        Location/Qualifiers
FT   CDS             complement(107555..108184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0097"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   xca:xccb100_3213 two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34071"
FT                   /db_xref="GOA:C6WDS6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34071.1"
FT                   /translation="MTIRVLLVDDHEVVRRGLRELLEDEADLKVVAEAGGVREAVVRAQ
FT                   ASKPDVAVVDMRLPDGTGVELCGKLQDLPGGPRCLVLTAFEDDEALVGAITAGASGYLL
FT                   KQVRGQDLVHAVREVAAGRSLLDPVTTSRVLERMRKPQEPDELATLTEQERRVLSLIGE
FT                   GLSNRQIAERLFVAEKTVKNHVTAVLSKLGMERRTQAAAWVARRGR"
     MTIRVLLVDD HEVVRRGLRE LLEDEADLKV VAEAGGVREA VVRAQASKPD VAVVDMRLPD        60
     GTGVELCGKL QDLPGGPRCL VLTAFEDDEA LVGAITAGAS GYLLKQVRGQ DLVHAVREVA       120
     AGRSLLDPVT TSRVLERMRK PQEPDELATL TEQERRVLSL IGEGLSNRQI AERLFVAEKT       180
     VKNHVTAVLS KLGMERRTQA AAWVARRGR                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page