(data stored in ACNUC7421 zone)

EMBL: CP001630.PE98

CP001630.PE98        Location/Qualifiers
FT   CDS             108245..108727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0098"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bca:BCE_4174 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34072"
FT                   /db_xref="GOA:C6WDS7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34072.1"
FT                   /translation="MLVRAIEEADRIVVGRLVLELWGTHTSVAHGQVFFPASLPGFLVE
FT                   QQDQVLGLLTYTTNDNLLEIVTIDALRRGRGVGTALLEAVVHRARQLGCNRIRLTTTND
FT                   NLDALRFYQRRGFRLTSLRSDAVRESRRVKPEIPSVGDYGIPIVDELDLERWVAPR"
     MLVRAIEEAD RIVVGRLVLE LWGTHTSVAH GQVFFPASLP GFLVEQQDQV LGLLTYTTND        60
     NLLEIVTIDA LRRGRGVGTA LLEAVVHRAR QLGCNRIRLT TTNDNLDALR FYQRRGFRLT       120
     SLRSDAVRES RRVKPEIPSV GDYGIPIVDE LDLERWVAPR                             160
//

If you have problems or comments...

PBIL Back to PBIL home page