(data stored in ACNUC7421 zone)

EMBL: CP001630.PE99

CP001630.PE99        Location/Qualifiers
FT   CDS             complement(108789..109388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0099"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   dal:Dalk_0690 Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34073"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS8"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ACU34073.1"
FT                   /translation="MAADTEGEINAPVVVPRLVLCAVDEPLTRAWAGVADGRTGVVVHR
FT                   GSVLDIVAEAVVSFGNSSGWLRTGVDELYARAFPHVEDQVRRAVLALHGGELPVGEALA
FT                   VPTCEPQPEWLVSAPTRRVLGERLPDDSVHPYLAARAVLRLWQTGRLDDGRLLRDVVRT
FT                   IAMPGLGTGVDGVSPWTCARQVAAAWDEVFSPIPRR"
     MAADTEGEIN APVVVPRLVL CAVDEPLTRA WAGVADGRTG VVVHRGSVLD IVAEAVVSFG        60
     NSSGWLRTGV DELYARAFPH VEDQVRRAVL ALHGGELPVG EALAVPTCEP QPEWLVSAPT       120
     RRVLGERLPD DSVHPYLAAR AVLRLWQTGR LDDGRLLRDV VRTIAMPGLG TGVDGVSPWT       180
     CARQVAAAWD EVFSPIPRR                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page