(data stored in ACNUC7421 zone)

EMBL: CP001658.PE10

CP001658.PE10        Location/Qualifiers
FT   CDS             complement(13235..13660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00010"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23031"
FT                   /protein_id="ACT23031.1"
FT                   /translation="MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAAL
FT                   GLILFASATWRARPRLAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEI
FT                   ETVSGGLLILSRWDLGTDPVEVLDALTAAGYAGRGQR"
     MQQTAWAPRT SGIAGCGAGG VVMAIASVTL VTDTPGRVLT GVAALGLILF ASATWRARPR        60
     LAITPDGLAI RGWFRTQLLR HSNIKIIRID EFRRYGRLVR LLEIETVSGG LLILSRWDLG       120
     TDPVEVLDAL TAAGYAGRGQ R                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page