(data stored in ACNUC7421 zone)

EMBL: CP001658.PE103

CP001658.PE103       Location/Qualifiers
FT   CDS             109914..110150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23124"
FT                   /protein_id="ACT23124.1"
FT                   /translation="MRDRILAAVCDVLYIDEADLIDGDETDLRDLGLDSVRFVLLMKQL
FT                   GVNRQSELPSRLAANPSIAGWLRELEAVCTEFG"
     MRDRILAAVC DVLYIDEADL IDGDETDLRD LGLDSVRFVL LMKQLGVNRQ SELPSRLAAN        60
     PSIAGWLREL EAVCTEFG                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page