(data stored in ACNUC7421 zone)

EMBL: CP001658.PE104

CP001658.PE104       Location/Qualifiers
FT   CDS             110132..117670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00102"
FT                   /product="peptide synthetase nrp"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23125"
FT                   /protein_id="ACT23125.1"
FT                   /translation="MHRVRLSRSQRNLYNGVRQDNNPALYLIGKSYRFRRLELARFLAA
FT                   LHATVLDNPVQLCVLENSGADYPDLVPRLRFGDIVRVGSADEHLQSTWCSGILGKPLVR
FT                   HTVHTDPNGYVTGLDVHTHHILLDGGATGTIEADLARYLTTDPAGETPSVGAGLAKLRE
FT                   AHRRETAKVEESRGRLSAVVQRELADEAYHGGHGHSVSDAPGTAAKGVLHESATICGNA
FT                   FDAILTLSEAQRVPLNVLVAAAAVAVDASLRQNTETLLVHTVDNRFGDSDLNVATCLVN
FT                   SVAQTVRFPPFASVSDVVRTLDRGYVKAVRRRWLREEHYRRMYLAINRTSHVEALTLNF
FT                   IREPCAPGLRPFLSEVPIATDIGPVEGMTVASVLDEEQRTLNLAIWNRADLPACKTHPK
FT                   VAERIAAALESMAAMWDRPIAMIVNDWFGIGPDGTRCQGDWPARQPSTPAWFLDPARGV
FT                   HQFLGRRRFVYPWVAWLVQRGAAPGDVLVFTDDDTDKTIDLLIACHLAGCGYSVCDTAD
FT                   EISVRTNAITEHGDGILVTVVDVAATQLAVVGHDELRKVVDERVTQVTHDALLATKTAY
FT                   IMPTSGTTGQPKLVRISHGSLAVFCDAISRAYGWGAHDTVLQCAPLTSDISVEEIFGGA
FT                   ACGARLVRSAAMKTGDLAALVDDLVARETTIVDLPTAVWQLLCADGDAIDAIGRSRLRQ
FT                   IVIGGEAIRCSAVDKWLESAASQGISLLSSYGPTEATVVATFLPIVCDQTTMDGALLRL
FT                   GRPILPNTVFLAFGEVVIVGDLVADGYLGIDGDGFGTVTAADGSRRRAFATGDRVTVDA
FT                   EGFPVFSGRKDAVVKISGKRVDIAEVTRRIAEDPAVSDVAVELHSGSLGVWFKSQRTRE
FT                   GEQDAAAATRIRLVLVSLGVSSFFVVGVPNIPRKPNGKIDSDNLPRLPQWSAAGLNTAE
FT                   TGQRAAGLSQIWSRQLGRAIGPDSSLLGEGIGSLDLIRILPETRRYLGWRLSLLDLIGA
FT                   DTAANLADYAPTPDAPTGEDRFRPLVAAQRPAAIPLSFAQRRLWFLDQLQRPAPVYNMA
FT                   VALRLRGYLDTEALGAAVADVVGRHESLRTVFPAVDGVPRQLVIEARRADLGCDIVDAT
FT                   AWPADRLQRAIEEAARHSFDLATEIPLRTWLFRIADDEHVLVAVAHHIAADGWSVAPLT
FT                   ADLSAAYASRCAGRAPDWAPLPVQYVDYTLWQREILGDLDDSDSPIAAQLAYWENALAG
FT                   MPERLRLPTARPYPPVADQRGASLVVDWPASVQQQVRRIARQHNATSFMVVAAGLAVLL
FT                   SKLSGSPDVAVGFPIAGRSDPALDNLVGFFVNTLVLRVNLAGDPSFAELLGQVRARSLA
FT                   AYENQDVPFEVLVDRLKPTRALTHHPLIQVMLAWQDNPVGQLNLGDLQATPMPIDTRTA
FT                   RMDLVFSLAERFSEGSEPAGIGGAVEYRTDVFEAQAIDVLIERLRKVLVAVAAAPERTV
FT                   SSIDALDGTERARLDEWGNRAVLTAPAPTPVSIPQMLAAQVARIPEAEAVCCGDASMTY
FT                   RELDEASNRLAHRLAGCGAGPGECVALLFERCAPAVVAMVAVLKTGAAYLPIDPANPPP
FT                   RVAFMLGDAVPVAAVTTAGLRSRLAGHDLPIIDVVDALAAYPGTPPPMPAAVNLAYILY
FT                   TSGTTGEPKGVGITHRNVTRLFASLPARLSAAQVWSQCHSYGFDASAWEIWGALLGGGR
FT                   LVIVPESVAASPNDFHGLLVAEHVSVLTQTPAAVAMLPTQGLESVALVVAGEACPAALV
FT                   DRWAPGRVMLNAYGPTETTICAAISAPLRPGSGMPPIGVPVSGAALFVLDSWLRPVPAG
FT                   VAGELYIAGAGVGVGYWRRAGLTASRFVACPFGGSGARMYRTGDLVCWRADGQLEFLGR
FT                   TDDQVKIRGYRIELGEVATALAELAGVGQAVVIAREDRPGDKRLVGYATEIAPGAVDPA
FT                   GLRAQLAQRLPGYLVPAAVVVIDALPLTVNGKLDHRALPAPEYGDTNGYRAPAGPVEKT
FT                   VAGIFARVLGLERVGVDDSFFELGGDSLAAMRVIAAINTTLNADLPVRALLHASSTRGL
FT                   SQLLGRDARPTSDPRLVSVHGDNPTEVHASDLTLDRFIDADTLATAVNLPGPSPELRTV
FT                   LLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDARRRLEKTFDSGDPELLRHFK
FT                   ELAADRLEVVAGDKSEPDLGLDQPMWRRLAETVDLIVDSAAMVNAFPYHELFGPNVAGT
FT                   AELIRIALTTKLKPFTYVSTADVGAAIEPSAFTEDADIRVISPTRTVDGGWAGGYGTSK
FT                   WAGEVLLREANDLCALPVAVFRCGMILADTSYAGQLNMSDWVTRMVLSLMATGIAPRSF
FT                   YEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFATYHVMNPHDDGIGLDEY
FT                   VDWLIEAGYPIRRIDDFAEWLQRFEASLGALPDRQRRHSVLPMLLASNSQRLQPLKPTR
FT                   GCSAPTDRFRAAVRAAKVGSDKDNPDIPHVSAPTIINYVTNLQLLGLL"
     MHRVRLSRSQ RNLYNGVRQD NNPALYLIGK SYRFRRLELA RFLAALHATV LDNPVQLCVL        60
     ENSGADYPDL VPRLRFGDIV RVGSADEHLQ STWCSGILGK PLVRHTVHTD PNGYVTGLDV       120
     HTHHILLDGG ATGTIEADLA RYLTTDPAGE TPSVGAGLAK LREAHRRETA KVEESRGRLS       180
     AVVQRELADE AYHGGHGHSV SDAPGTAAKG VLHESATICG NAFDAILTLS EAQRVPLNVL       240
     VAAAAVAVDA SLRQNTETLL VHTVDNRFGD SDLNVATCLV NSVAQTVRFP PFASVSDVVR       300
     TLDRGYVKAV RRRWLREEHY RRMYLAINRT SHVEALTLNF IREPCAPGLR PFLSEVPIAT       360
     DIGPVEGMTV ASVLDEEQRT LNLAIWNRAD LPACKTHPKV AERIAAALES MAAMWDRPIA       420
     MIVNDWFGIG PDGTRCQGDW PARQPSTPAW FLDPARGVHQ FLGRRRFVYP WVAWLVQRGA       480
     APGDVLVFTD DDTDKTIDLL IACHLAGCGY SVCDTADEIS VRTNAITEHG DGILVTVVDV       540
     AATQLAVVGH DELRKVVDER VTQVTHDALL ATKTAYIMPT SGTTGQPKLV RISHGSLAVF       600
     CDAISRAYGW GAHDTVLQCA PLTSDISVEE IFGGAACGAR LVRSAAMKTG DLAALVDDLV       660
     ARETTIVDLP TAVWQLLCAD GDAIDAIGRS RLRQIVIGGE AIRCSAVDKW LESAASQGIS       720
     LLSSYGPTEA TVVATFLPIV CDQTTMDGAL LRLGRPILPN TVFLAFGEVV IVGDLVADGY       780
     LGIDGDGFGT VTAADGSRRR AFATGDRVTV DAEGFPVFSG RKDAVVKISG KRVDIAEVTR       840
     RIAEDPAVSD VAVELHSGSL GVWFKSQRTR EGEQDAAAAT RIRLVLVSLG VSSFFVVGVP       900
     NIPRKPNGKI DSDNLPRLPQ WSAAGLNTAE TGQRAAGLSQ IWSRQLGRAI GPDSSLLGEG       960
     IGSLDLIRIL PETRRYLGWR LSLLDLIGAD TAANLADYAP TPDAPTGEDR FRPLVAAQRP      1020
     AAIPLSFAQR RLWFLDQLQR PAPVYNMAVA LRLRGYLDTE ALGAAVADVV GRHESLRTVF      1080
     PAVDGVPRQL VIEARRADLG CDIVDATAWP ADRLQRAIEE AARHSFDLAT EIPLRTWLFR      1140
     IADDEHVLVA VAHHIAADGW SVAPLTADLS AAYASRCAGR APDWAPLPVQ YVDYTLWQRE      1200
     ILGDLDDSDS PIAAQLAYWE NALAGMPERL RLPTARPYPP VADQRGASLV VDWPASVQQQ      1260
     VRRIARQHNA TSFMVVAAGL AVLLSKLSGS PDVAVGFPIA GRSDPALDNL VGFFVNTLVL      1320
     RVNLAGDPSF AELLGQVRAR SLAAYENQDV PFEVLVDRLK PTRALTHHPL IQVMLAWQDN      1380
     PVGQLNLGDL QATPMPIDTR TARMDLVFSL AERFSEGSEP AGIGGAVEYR TDVFEAQAID      1440
     VLIERLRKVL VAVAAAPERT VSSIDALDGT ERARLDEWGN RAVLTAPAPT PVSIPQMLAA      1500
     QVARIPEAEA VCCGDASMTY RELDEASNRL AHRLAGCGAG PGECVALLFE RCAPAVVAMV      1560
     AVLKTGAAYL PIDPANPPPR VAFMLGDAVP VAAVTTAGLR SRLAGHDLPI IDVVDALAAY      1620
     PGTPPPMPAA VNLAYILYTS GTTGEPKGVG ITHRNVTRLF ASLPARLSAA QVWSQCHSYG      1680
     FDASAWEIWG ALLGGGRLVI VPESVAASPN DFHGLLVAEH VSVLTQTPAA VAMLPTQGLE      1740
     SVALVVAGEA CPAALVDRWA PGRVMLNAYG PTETTICAAI SAPLRPGSGM PPIGVPVSGA      1800
     ALFVLDSWLR PVPAGVAGEL YIAGAGVGVG YWRRAGLTAS RFVACPFGGS GARMYRTGDL      1860
     VCWRADGQLE FLGRTDDQVK IRGYRIELGE VATALAELAG VGQAVVIARE DRPGDKRLVG      1920
     YATEIAPGAV DPAGLRAQLA QRLPGYLVPA AVVVIDALPL TVNGKLDHRA LPAPEYGDTN      1980
     GYRAPAGPVE KTVAGIFARV LGLERVGVDD SFFELGGDSL AAMRVIAAIN TTLNADLPVR      2040
     ALLHASSTRG LSQLLGRDAR PTSDPRLVSV HGDNPTEVHA SDLTLDRFID ADTLATAVNL      2100
     PGPSPELRTV LLTGATGFLG RYLVLELLRR LDVDGRLICL VRAESDEDAR RRLEKTFDSG      2160
     DPELLRHFKE LAADRLEVVA GDKSEPDLGL DQPMWRRLAE TVDLIVDSAA MVNAFPYHEL      2220
     FGPNVAGTAE LIRIALTTKL KPFTYVSTAD VGAAIEPSAF TEDADIRVIS PTRTVDGGWA      2280
     GGYGTSKWAG EVLLREANDL CALPVAVFRC GMILADTSYA GQLNMSDWVT RMVLSLMATG      2340
     IAPRSFYEPD SEGNRQRAHF DGLPVTFVAE AIAVLGARVA GSSLAGFATY HVMNPHDDGI      2400
     GLDEYVDWLI EAGYPIRRID DFAEWLQRFE ASLGALPDRQ RRHSVLPMLL ASNSQRLQPL      2460
     KPTRGCSAPT DRFRAAVRAA KVGSDKDNPD IPHVSAPTII NYVTNLQLLG LL              2512
//

If you have problems or comments...

PBIL Back to PBIL home page