(data stored in ACNUC7421 zone)

EMBL: CP001658.PE105

CP001658.PE105       Location/Qualifiers
FT   CDS             117845..119830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00103"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23126"
FT                   /protein_id="ACT23126.1"
FT                   /translation="MGTHGATKSATSAVPTPRSNSMAMVRLAIGLLGVCAVVAAFGLVS
FT                   GARRYAEAGNPYPGAFVSVAEPVGFFAASLAGALCLGALIHVVMTAKPEPDGLIDAAAF
FT                   RIHLLAERVSGLWLGLAATMVVIQAAHDTGVGPARLLASGALSDSVAASEMARGWIVAA
FT                   ICALVVATALRLYTRWLGHVVLLVPTVLAVVATAVTGNPGQGPDHDYATSAAIVFAVAF
FT                   ATLTGLKIAAALAGTTPSRAVLVTQVTCGALALAYGAMLLYLFIPGWAVDSDFARLGLL
FT                   AGVILTSVWLFDCWRLLVRPPHAGRRRGGGSGAALAMMAAMASIAAMAVMTAPRFLTHA
FT                   FTAWDVFLGYELPQPPTIARVLTVWRFDSLIGAAGVVLAIGYAAGFAALRRRGNSWPVG
FT                   RLIAWLTGCAALVFTSGSGVRAYGSAMFSVHMAEHMTLNMFIPVLLVLGGPVTLALRVL
FT                   PVTGDGRPPGAREWLTWLLHSRVTTFLSHPITAFVLFVASPYIVYFTPLFDTFVRYHWG
FT                   HEFMAIHFLVVGYLFYWAIIGIDPGPRRLPYPGRIGLLFAVMPFHAFFGIALMTMSSTV
FT                   GATFYRSVNLPWLSSIIADQHLGGGIAWSLTELPVIMVIVALVTQWARQDRRVASREDR
FT                   HADSDYADDELEAYNAMLRELSRMRR"
     MGTHGATKSA TSAVPTPRSN SMAMVRLAIG LLGVCAVVAA FGLVSGARRY AEAGNPYPGA        60
     FVSVAEPVGF FAASLAGALC LGALIHVVMT AKPEPDGLID AAAFRIHLLA ERVSGLWLGL       120
     AATMVVIQAA HDTGVGPARL LASGALSDSV AASEMARGWI VAAICALVVA TALRLYTRWL       180
     GHVVLLVPTV LAVVATAVTG NPGQGPDHDY ATSAAIVFAV AFATLTGLKI AAALAGTTPS       240
     RAVLVTQVTC GALALAYGAM LLYLFIPGWA VDSDFARLGL LAGVILTSVW LFDCWRLLVR       300
     PPHAGRRRGG GSGAALAMMA AMASIAAMAV MTAPRFLTHA FTAWDVFLGY ELPQPPTIAR       360
     VLTVWRFDSL IGAAGVVLAI GYAAGFAALR RRGNSWPVGR LIAWLTGCAA LVFTSGSGVR       420
     AYGSAMFSVH MAEHMTLNMF IPVLLVLGGP VTLALRVLPV TGDGRPPGAR EWLTWLLHSR       480
     VTTFLSHPIT AFVLFVASPY IVYFTPLFDT FVRYHWGHEF MAIHFLVVGY LFYWAIIGID       540
     PGPRRLPYPG RIGLLFAVMP FHAFFGIALM TMSSTVGATF YRSVNLPWLS SIIADQHLGG       600
     GIAWSLTELP VIMVIVALVT QWARQDRRVA SREDRHADSD YADDELEAYN AMLRELSRMR       660
     R                                                                       661
//

If you have problems or comments...

PBIL Back to PBIL home page