(data stored in ACNUC7421 zone)

EMBL: CP001658.PE108

CP001658.PE108       Location/Qualifiers
FT   CDS             complement(124111..124395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00106"
FT                   /product="50S ribosomal protein rpmB1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23129"
FT                   /protein_id="ACT23129.1"
FT                   /translation="MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDR
FT                   RIKVRVSAQGIKVIDRDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL"
     MSARCQITGR TVGFGKAVSH SHRRTRRRWP PNIQLKAYYL PSEDRRIKVR VSAQGIKVID        60
     RDGHRGRRRA ARAGSAPAHF ARQAGSSLRT AAIL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page