(data stored in ACNUC7421 zone)

EMBL: CP001658.PE11

CP001658.PE11        Location/Qualifiers
FT   CDS             complement(13816..14097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00011"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23032"
FT                   /protein_id="ACT23032.1"
FT                   /translation="MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGL
FT                   IWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH"
     MPKSKVRKKN DFTVSAVSRT PMKVKVGPSS VWFVSLFIGL MLIGLIWLMV FQLAAIGSQA        60
     PTALNWMAQL GPWNYAIAFA FMITGLLLTM RWH                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page