(data stored in ACNUC7421 zone)

EMBL: CP001658.PE111

CP001658.PE111       Location/Qualifiers
FT   CDS             complement(131027..131260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23132"
FT                   /protein_id="ACT23132.1"
FT                   /translation="MESNGNPDLVPVETLHSGDPITDVNGGGQRYIVLESKTVGDSCVV
FT                   LELESRVNHQLQVIEKSFPAGYHVGRAHHRIL"
     MESNGNPDLV PVETLHSGDP ITDVNGGGQR YIVLESKTVG DSCVVLELES RVNHQLQVIE        60
     KSFPAGYHVG RAHHRIL                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page