(data stored in ACNUC7421 zone)

EMBL: CP001658.PE112

CP001658.PE112       Location/Qualifiers
FT   CDS             131404..133005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00110"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23133"
FT                   /protein_id="ACT23133.1"
FT                   /translation="MRVGQPNPRNWRNVPRKPRYIWLLATRQLARKRQRSLMSLLITSP
FT                   ATVAAAATHLAGIGSALSTANAAAAAPTTALSVAGADEVSVLIAALFEAYAQEYQALSA
FT                   QALAFHDQFVQALNMGAVCYAAAETANATPLQALQTVQQNVLTVVNAPTQALLGRPIIG
FT                   NGANGLPNTGQDGGPGGLLFGNGGNGGSGGVDQAGGNGGAAGLIGNGGSGGVGGPGIAG
FT                   SAGGAGGAGGLLFGNGGPGGAGGIGTTGDGGPGGAGGNAIGLFGSGGTGGMGGVGGMGG
FT                   VGNGGNAGNGGTAGLFGHGGAGGAGGIGSADGGLGGGGGNGRFMGNGGVGGAGGYGASG
FT                   DGGNAGNGGLGGVFGDGGAGGTGGLGDVNGGLAGIGGNAGFVGNGGAGGNGQLGSGAVS
FT                   SAGGMGGNGGLVFGNGGPGGLGGPGTSAGNGGMGGNAVGLFGQGGAGGAGGSGFGAGIP
FT                   GGRGGDGGSGGLIGDGGTGGGAGAGDAAASAGGNGGNARLIGNGGDGGPGMFGGPGGAG
FT                   GSGGTIFGFAGTPGPS"
     MRVGQPNPRN WRNVPRKPRY IWLLATRQLA RKRQRSLMSL LITSPATVAA AATHLAGIGS        60
     ALSTANAAAA APTTALSVAG ADEVSVLIAA LFEAYAQEYQ ALSAQALAFH DQFVQALNMG       120
     AVCYAAAETA NATPLQALQT VQQNVLTVVN APTQALLGRP IIGNGANGLP NTGQDGGPGG       180
     LLFGNGGNGG SGGVDQAGGN GGAAGLIGNG GSGGVGGPGI AGSAGGAGGA GGLLFGNGGP       240
     GGAGGIGTTG DGGPGGAGGN AIGLFGSGGT GGMGGVGGMG GVGNGGNAGN GGTAGLFGHG       300
     GAGGAGGIGS ADGGLGGGGG NGRFMGNGGV GGAGGYGASG DGGNAGNGGL GGVFGDGGAG       360
     GTGGLGDVNG GLAGIGGNAG FVGNGGAGGN GQLGSGAVSS AGGMGGNGGL VFGNGGPGGL       420
     GGPGTSAGNG GMGGNAVGLF GQGGAGGAGG SGFGAGIPGG RGGDGGSGGL IGDGGTGGGA       480
     GAGDAAASAG GNGGNARLIG NGGDGGPGMF GGPGGAGGSG GTIFGFAGTP GPS              533
//

If you have problems or comments...

PBIL Back to PBIL home page