(data stored in ACNUC7421 zone)

EMBL: CP001658.PE127

CP001658.PE127       Location/Qualifiers
FT   CDS             149624..150769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03975"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03975"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23148"
FT                   /protein_id="ACT23148.1"
FT                   /translation="MFAGGGAGGLGRCVMSFVSVAPEIVVAAATDLAGIGSAISAANAA
FT                   AAAPTTAVLAAGADEVSAAIAALFSGHAQAYQALSAQAAAFHQQFVQTLAGGAGAYAAA
FT                   EAQVEQQLLAAINAPTQALLGRPLIGNGADGAPGTGQAGGAGGILYGNGGNGGSGAAGQ
FT                   AGGAGGPAGLIGHGGSGGAGGSGAAGGAGGHGGWLWGNGGVGGSGGAGGRRRRGWRSRR
FT                   CGRCRRAVGRRRRRWQWRERRRCQHRQRWRRWPRRCRWRWRMALRRRRGRRTRRTRRNR
FT                   PRRRRRRRRGPGRRRPRTVGYWRRRRTRRARRWYRGPTAARSGRHGRRGWRRWADRQRR
FT                   GRRRRRCRRVRRGRRSRRCRRERHADRARRRRRRRRRQQFR"
     MFAGGGAGGL GRCVMSFVSV APEIVVAAAT DLAGIGSAIS AANAAAAAPT TAVLAAGADE        60
     VSAAIAALFS GHAQAYQALS AQAAAFHQQF VQTLAGGAGA YAAAEAQVEQ QLLAAINAPT       120
     QALLGRPLIG NGADGAPGTG QAGGAGGILY GNGGNGGSGA AGQAGGAGGP AGLIGHGGSG       180
     GAGGSGAAGG AGGHGGWLWG NGGVGGSGGA GGRRRRGWRS RRCGRCRRAV GRRRRRWQWR       240
     ERRRCQHRQR WRRWPRRCRW RWRMALRRRR GRRTRRTRRN RPRRRRRRRR GPGRRRPRTV       300
     GYWRRRRTRR ARRWYRGPTA ARSGRHGRRG WRRWADRQRR GRRRRRCRRV RRGRRSRRCR       360
     RERHADRARR RRRRRRRQQF R                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page