(data stored in ACNUC7421 zone)

EMBL: CP001658.PE134

CP001658.PE134       Location/Qualifiers
FT   CDS             158108..158563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23155"
FT                   /protein_id="ACT23155.1"
FT                   /translation="MRTFESVADLAAAAGEKVGQSDWVTITQEEVNLFADATGDHQWIH
FT                   VDPERAAAGPFGTTIAHGFMTLALLPRLQHQMYTVKGVKLAINYGLNKVRFPAPVPVGS
FT                   RVRATSSLVGVEDLGNGTVQATVSTTVEVEGSAKPACVAESIVRYVA"
     MRTFESVADL AAAAGEKVGQ SDWVTITQEE VNLFADATGD HQWIHVDPER AAAGPFGTTI        60
     AHGFMTLALL PRLQHQMYTV KGVKLAINYG LNKVRFPAPV PVGSRVRATS SLVGVEDLGN       120
     GTVQATVSTT VEVEGSAKPA CVAESIVRYV A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page