(data stored in ACNUC7421 zone)

EMBL: CP001658.PE145

CP001658.PE145       Location/Qualifiers
FT   CDS             complement(167532..167942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23166"
FT                   /protein_id="ACT23166.1"
FT                   /translation="MTPFDDPQAELAWMFLQSLCEGGDLDEGFALLSNDFTYWSIVTRT
FT                   ELDKKTFRRAVERRKQVFEVNIELIRCVNEGETVVVEGHCDGVSADRTRYDSPFVCIFE
FT                   TRDGMIISLREYSDTQSLAEVYPVACATPGRC"
     MTPFDDPQAE LAWMFLQSLC EGGDLDEGFA LLSNDFTYWS IVTRTELDKK TFRRAVERRK        60
     QVFEVNIELI RCVNEGETVV VEGHCDGVSA DRTRYDSPFV CIFETRDGMI ISLREYSDTQ       120
     SLAEVYPVAC ATPGRC                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page