(data stored in ACNUC7421 zone)

EMBL: CP001658.PE146

CP001658.PE146       Location/Qualifiers
FT   CDS             167972..168898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23167"
FT                   /protein_id="ACT23167.1"
FT                   /translation="MRSIDVVVEAVVTFAGAAGFAHTLAPLRRGQQDPCFRVPGDGTIW
FT                   RTSLLPTGPVTARISRAGRDAARCVAWGSGAEEFVDMAPAMLGAADDASDFVPLHPAVA
FT                   AAHRRLPNLRLGRTGQVLEALIPAVIEQRVPGADAFRSWRLLVSKYGTQAPGPAPPGMR
FT                   VPPSAEVWRHIPSWEFHRANVDPGRARAVVGCAQRAASLERLVSLPAARAAEALTSLPG
FT                   VGVWTAAETTQRVFGDADAVSVGDYHIPKMIGWTLVGRPVDDAGMLELLEPMRPHRHRV
FT                   VRLLEASGLAREPRRGPRLPVQNIRAL"
     MRSIDVVVEA VVTFAGAAGF AHTLAPLRRG QQDPCFRVPG DGTIWRTSLL PTGPVTARIS        60
     RAGRDAARCV AWGSGAEEFV DMAPAMLGAA DDASDFVPLH PAVAAAHRRL PNLRLGRTGQ       120
     VLEALIPAVI EQRVPGADAF RSWRLLVSKY GTQAPGPAPP GMRVPPSAEV WRHIPSWEFH       180
     RANVDPGRAR AVVGCAQRAA SLERLVSLPA ARAAEALTSL PGVGVWTAAE TTQRVFGDAD       240
     AVSVGDYHIP KMIGWTLVGR PVDDAGMLEL LEPMRPHRHR VVRLLEASGL AREPRRGPRL       300
     PVQNIRAL                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page