(data stored in ACNUC7421 zone)

EMBL: CP001658.PE15

CP001658.PE15        Location/Qualifiers
FT   CDS             complement(17569..18846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00015"
FT                   /product="transmembrane serine/threonine-protein kinase A
FT                   pknA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23036"
FT                   /protein_id="ACT23036.1"
FT                   /translation="MTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSD
FT                   PEFIERFRAEARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLNSVLKRT
FT                   GRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAA
FT                   PVTQTGMVMGTAQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMK
FT                   HIKEPPPPLPPDLPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQTP
FT                   PPGRAAPAAIPSGTTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRALLWAAGV
FT                   LGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPARNTGGTDASPRLNWTERGETR
FT                   HSGLQSWVVPPTPHSRASLARYEIAQ"
     MTLSGRYRLQ RLIATGGMGQ VWEAVDNRLG RRVAVKVLKS EFSSDPEFIE RFRAEARTTA        60
     MLNHPGIASV HDYGESQMNG EGRTAYLVME LVNGEPLNSV LKRTGRLSLR HALDMLEQTG       120
     RALQIAHAAG LVHRDVKPGN ILITPTGQVK ITDFGIAKAV DAAPVTQTGM VMGTAQYIAP       180
     EQALGHDASP ASDVYSLGVV GYEAVSGKRP FAGDGALTVA MKHIKEPPPP LPPDLPPNVR       240
     ELIEITLVKN PAMRYRSGGP FADAVAAVRA GRRPPRPSQT PPPGRAAPAA IPSGTTARVA       300
     ANSAGRTAAS RRSRPATGGH RPPRRTFSSG QRALLWAAGV LGALAIIIAV LLVIKAPGDN       360
     SPQQAPTPTV TTTGNPPARN TGGTDASPRL NWTERGETRH SGLQSWVVPP TPHSRASLAR       420
     YEIAQ                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page