(data stored in ACNUC7421 zone)

EMBL: CP001658.PE150

CP001658.PE150       Location/Qualifiers
FT   CDS             171742..172107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03977"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03977"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23171"
FT                   /protein_id="ACT23171.1"
FT                   /translation="MLPYLPGDAADRLFDMVTALSAPGSQVAVEAFTMNTKGNTQRWNR
FT                   MRERLGLDIDVQALTYHEPDRSDAAQWLATHGWQVHSVSNREEMARLGRAIPQDLVDET
FT                   VRTTLLRGRLVTPAQPA"
     MLPYLPGDAA DRLFDMVTAL SAPGSQVAVE AFTMNTKGNT QRWNRMRERL GLDIDVQALT        60
     YHEPDRSDAA QWLATHGWQV HSVSNREEMA RLGRAIPQDL VDETVRTTLL RGRLVTPAQP       120
     A                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page