(data stored in ACNUC7421 zone)

EMBL: CP001658.PE156

CP001658.PE156       Location/Qualifiers
FT   CDS             complement(177482..179248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00152"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23177"
FT                   /protein_id="ACT23177.1"
FT                   /translation="MAPFGFTPKARHNRGVALRSTYRLDGWVMGPVDKEGWGLSYVFAQ
FT                   PSVLAAAATDLAGIGSAINQATAAVAAPTTGLAAAAADEVSTALATLFGAYGQQFQAIS
FT                   AQVAAFHNEFTQRLAAAAKAFVNAEATNTSALVQEATAGLFKPTSPPVLPPMFNQNTAI
FT                   IMGGTGSPIPTPSYVNAITTLFIDPVVSNPVVKALVTPEELYPITGVKSLPFQTSVQLG
FT                   LQILDGAIWEQINAGNHVTVFGYSQSAVIASLEMQHLISLGPNAPSPSQLNFILIGNEM
FT                   NPNGGILARIPGLNVTTLGLPFYGATPDNPYPTTTYTLEYDGFADFPRYPLNVLSDINA
FT                   VFGILTVHTTYADLTPAQIASATQLPTQGTTSNTYYIIETEHLPLLAPLRAIPVIGPPL
FT                   AALVEPNLEVIVNLGYGDPRFGYSTSPANVPTPFGLFPDVPASVVADALVAGTQQGVND
FT                   FMVELPAALNTLPQTPMPAFPPYVPTLLPPPPPPQPATLINIADTFASVVSTGYSILLP
FT                   TADLGLAFVTILPAYDLTLFVNQLAAGNLRAAIELPLAATIGLAALGGMIEFIAIVVTL
FT                   ADITQQLQSFSI"
     MAPFGFTPKA RHNRGVALRS TYRLDGWVMG PVDKEGWGLS YVFAQPSVLA AAATDLAGIG        60
     SAINQATAAV AAPTTGLAAA AADEVSTALA TLFGAYGQQF QAISAQVAAF HNEFTQRLAA       120
     AAKAFVNAEA TNTSALVQEA TAGLFKPTSP PVLPPMFNQN TAIIMGGTGS PIPTPSYVNA       180
     ITTLFIDPVV SNPVVKALVT PEELYPITGV KSLPFQTSVQ LGLQILDGAI WEQINAGNHV       240
     TVFGYSQSAV IASLEMQHLI SLGPNAPSPS QLNFILIGNE MNPNGGILAR IPGLNVTTLG       300
     LPFYGATPDN PYPTTTYTLE YDGFADFPRY PLNVLSDINA VFGILTVHTT YADLTPAQIA       360
     SATQLPTQGT TSNTYYIIET EHLPLLAPLR AIPVIGPPLA ALVEPNLEVI VNLGYGDPRF       420
     GYSTSPANVP TPFGLFPDVP ASVVADALVA GTQQGVNDFM VELPAALNTL PQTPMPAFPP       480
     YVPTLLPPPP PPQPATLINI ADTFASVVST GYSILLPTAD LGLAFVTILP AYDLTLFVNQ       540
     LAAGNLRAAI ELPLAATIGL AALGGMIEFI AIVVTLADIT QQLQSFSI                    588
//

If you have problems or comments...

PBIL Back to PBIL home page