(data stored in ACNUC7421 zone)

EMBL: CP001658.PE158

CP001658.PE158       Location/Qualifiers
FT   CDS             complement(181094..181924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00154"
FT                   /product="phosphotyrosine protein phosphatase ptpb"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23179"
FT                   /protein_id="ACT23179.1"
FT                   /translation="MAVRELPGAWNFRDVADTATALRPGRLFRSSELSRLDDAGRATLR
FT                   RLGITDVADLRSSREVARRGPGRVPDGIDVHLLPFPDLADDDADDSAPHETAFKRLLTN
FT                   DGSNGESGESSQSINDAATRYMTDEYRQFPTRNGAQRALHRVVTLLAAGRPVLTHCFAG
FT                   KDRTGFVVALVLEAVGLDRDVIVADYLRSNDSVPQLRARISEMIQQRFDTELAPEVVTF
FT                   TKARLSDGVLGVRAEYLAAARQTIDETYGSLGGYLRDAGISQATVNRMRGVLLG"
     MAVRELPGAW NFRDVADTAT ALRPGRLFRS SELSRLDDAG RATLRRLGIT DVADLRSSRE        60
     VARRGPGRVP DGIDVHLLPF PDLADDDADD SAPHETAFKR LLTNDGSNGE SGESSQSIND       120
     AATRYMTDEY RQFPTRNGAQ RALHRVVTLL AAGRPVLTHC FAGKDRTGFV VALVLEAVGL       180
     DRDVIVADYL RSNDSVPQLR ARISEMIQQR FDTELAPEVV TFTKARLSDG VLGVRAEYLA       240
     AARQTIDETY GSLGGYLRDA GISQATVNRM RGVLLG                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page