(data stored in ACNUC7421 zone)

EMBL: CP001658.PE161

CP001658.PE161       Location/Qualifiers
FT   CDS             183561..184661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00156"
FT                   /product="NAD(P) transhydrogenase alpha subunit pntAa"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23182"
FT                   /protein_id="ACT23182.1"
FT                   /translation="MTDPQTQSTRVGVVAESGPDERRVALVPKAVASLVNRGVAVVVEA
FT                   GAGERALLPDELYTAVGASIGDAWAADVVVKVAPPTAAEVGRLRGGQTLIGFLAPRNAD
FT                   NSIGALTQAGVQAFALEAIPRISRAQVMDALSSQANVSGYKAVLLAASESTRFFPMLTT
FT                   AAGTVKPATVLVLGVGVAGLQALATAKRLGARTTGYDVRPEVADQVRSVGAQWLDLGIS
FT                   ASGEGGYARELTDDERAQQQKALEEAISGFDVVITTALVPGRPAPTLVTAAAVEAMKPG
FT                   SVVVDLAGETGGNCELTEPGRTVVKHDVTIAAPLNLPATMPEHASELYSKNITALLDLL
FT                   IKDGRLAPDFDDEVIAQSCVTRGKDS"
     MTDPQTQSTR VGVVAESGPD ERRVALVPKA VASLVNRGVA VVVEAGAGER ALLPDELYTA        60
     VGASIGDAWA ADVVVKVAPP TAAEVGRLRG GQTLIGFLAP RNADNSIGAL TQAGVQAFAL       120
     EAIPRISRAQ VMDALSSQAN VSGYKAVLLA ASESTRFFPM LTTAAGTVKP ATVLVLGVGV       180
     AGLQALATAK RLGARTTGYD VRPEVADQVR SVGAQWLDLG ISASGEGGYA RELTDDERAQ       240
     QQKALEEAIS GFDVVITTAL VPGRPAPTLV TAAAVEAMKP GSVVVDLAGE TGGNCELTEP       300
     GRTVVKHDVT IAAPLNLPAT MPEHASELYS KNITALLDLL IKDGRLAPDF DDEVIAQSCV       360
     TRGKDS                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page