(data stored in ACNUC7421 zone)

EMBL: CP001658.PE175

CP001658.PE175       Location/Qualifiers
FT   CDS             197599..198468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00169"
FT                   /product="hypothetical membrane protein yrbE1B"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23196"
FT                   /protein_id="ACT23196.1"
FT                   /translation="MSTAAVLRARFPRAVANLRQYGGAAARGLDEAGQLTWFALTSIGQ
FT                   IAHALRYYRKETLRLIAQIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIG
FT                   VEAFTGFFAALINVRIAGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSIS
FT                   FLASTRIMAGLVVIIPLYALAMIMSFLSPQITTTVLYGQSNGTYEHYFQTFLRPDDVFW
FT                   SFLEALIITAIVMVSHCYYGYAAGGGPVGVGEAVGRSMRFSLVSVQVVVLFAALALYGV
FT                   DPNFNLTV"
     MSTAAVLRAR FPRAVANLRQ YGGAAARGLD EAGQLTWFAL TSIGQIAHAL RYYRKETLRL        60
     IAQIGMGTGA MAVVGGTVAI VGFVTLSGSS LVAIQGFASL GNIGVEAFTG FFAALINVRI       120
     AGPVVTGVAL AATVGAGATA ELGAMRISEE IDALEVMGIK SISFLASTRI MAGLVVIIPL       180
     YALAMIMSFL SPQITTTVLY GQSNGTYEHY FQTFLRPDDV FWSFLEALII TAIVMVSHCY       240
     YGYAAGGGPV GVGEAVGRSM RFSLVSVQVV VLFAALALYG VDPNFNLTV                   289
//

If you have problems or comments...

PBIL Back to PBIL home page