(data stored in ACNUC7421 zone)

EMBL: CP001658.PE177

CP001658.PE177       Location/Qualifiers
FT   CDS             199834..200874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00171"
FT                   /product="MCE-family protein mce1B"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23198"
FT                   /protein_id="ACT23198.1"
FT                   /translation="MKITGTVVKLGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEFSN
FT                   VSGLRQGQFVRASGVEIGKVKALHLVDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIG
FT                   NRYVELKRGEGKGANDLLPPGGLIPLSRTSPALDLDALIGGFKPVFRALDPAKVNNIAN
FT                   ALITVFQGQGGTINDILDQTAQLTSQIAERDQAIGEVVKNLNIVLDTTVKHRKEFDETV
FT                   NNLENLITGLRNHSDQLAGGLAHISNGAGTVADLLAENRTLVRKAVSYLDAIQQPVIDQ
FT                   RVELDDLLHKTPTALTALGRANGTYGDFQNFYLCDLQIKWNGFQAGGPVRTVKLFSQPT
FT                   GRCTPQ"
     MKITGTVVKL GIVSVVLLFF TVMIIVIFGQ MRFDRTNGYT AEFSNVSGLR QGQFVRASGV        60
     EIGKVKALHL VDGGRRVRVE FNIDRSVPLY QSTTAQIRYS DLIGNRYVEL KRGEGKGAND       120
     LLPPGGLIPL SRTSPALDLD ALIGGFKPVF RALDPAKVNN IANALITVFQ GQGGTINDIL       180
     DQTAQLTSQI AERDQAIGEV VKNLNIVLDT TVKHRKEFDE TVNNLENLIT GLRNHSDQLA       240
     GGLAHISNGA GTVADLLAEN RTLVRKAVSY LDAIQQPVID QRVELDDLLH KTPTALTALG       300
     RANGTYGDFQ NFYLCDLQIK WNGFQAGGPV RTVKLFSQPT GRCTPQ                      346
//

If you have problems or comments...

PBIL Back to PBIL home page