(data stored in ACNUC7421 zone)

EMBL: CP001658.PE178

CP001658.PE178       Location/Qualifiers
FT   CDS             200913..202418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00172"
FT                   /product="MCE-family protein mce1C"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23199"
FT                   /protein_id="ACT23199.1"
FT                   /translation="MGIVVALLVVAVGQSFTSVPMLFAKPSYYGQFTDSGGLHKGDRVR
FT                   IAGLGVGTVEGLKIDGDHIVVKFSIGTNTIGTESRLAIRTDTILGRKVLEIEPRGAQAL
FT                   PPGGVLPVGQSTTPYQIYDAFFDVTKAASGWDIETVKRSLNVLSETVDQTYPHLSAALD
FT                   GVAKFSDTIGKRDEQITHLLAQANQVASILGDRSEQVDRLLVNAKTLIAAFNERGRAVD
FT                   ALLGNISAFSAQVQNLINDNPNLNHVLEQLRILTDLLVDRKEDLAETLTILGRFSASFG
FT                   ETFASGPYFKVLLANLVPGQILQPFVDAAFKKRGISPEDFWRSAGLPAYRWPDPNGTRF
FT                   PNGAPPPPPPVLEGTPEHPGPAVPPGSPCSYTPPADGLPRPWDPLPCANLTQGPFGGPD
FT                   FPAPLDVATSPPNPDGPPPAPGLPIAGRPGEVPPNVPGTPVPIPQEAPPGARTLPLGPA
FT                   PGPAPPPAAPGPPAPPGPGPQLPAPFINPGGTGGSGVTGGSEN"
     MGIVVALLVV AVGQSFTSVP MLFAKPSYYG QFTDSGGLHK GDRVRIAGLG VGTVEGLKID        60
     GDHIVVKFSI GTNTIGTESR LAIRTDTILG RKVLEIEPRG AQALPPGGVL PVGQSTTPYQ       120
     IYDAFFDVTK AASGWDIETV KRSLNVLSET VDQTYPHLSA ALDGVAKFSD TIGKRDEQIT       180
     HLLAQANQVA SILGDRSEQV DRLLVNAKTL IAAFNERGRA VDALLGNISA FSAQVQNLIN       240
     DNPNLNHVLE QLRILTDLLV DRKEDLAETL TILGRFSASF GETFASGPYF KVLLANLVPG       300
     QILQPFVDAA FKKRGISPED FWRSAGLPAY RWPDPNGTRF PNGAPPPPPP VLEGTPEHPG       360
     PAVPPGSPCS YTPPADGLPR PWDPLPCANL TQGPFGGPDF PAPLDVATSP PNPDGPPPAP       420
     GLPIAGRPGE VPPNVPGTPV PIPQEAPPGA RTLPLGPAPG PAPPPAAPGP PAPPGPGPQL       480
     PAPFINPGGT GGSGVTGGSE N                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page