(data stored in ACNUC7421 zone)

EMBL: CP001658.PE179

CP001658.PE179       Location/Qualifiers
FT   CDS             202415..204007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00173"
FT                   /product="MCE-family protein mce1D"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23200"
FT                   /protein_id="ACT23200.1"
FT                   /translation="MSTIFDIRNLRLPQLSRASVVIGSLVVVLALAAGIVGVRLYQKLT
FT                   NNTVVAYFTQANALYVGDKVQIMGLPVGSIDKIEPAGDKMKVTFHYQNKYKVPANASAV
FT                   ILNPTLVASRNIQLEPPYRGGPVLADNAVIPVERTQVPTEWDELRDSVSHIIDELGPTP
FT                   EQPKGPFGEVIEAFADGLAGKGKQINTTLNSLSQALNALNEGRGDFFAVVRSLALFVNA
FT                   LHQDDQQFVALNKNLAEFTDRLTHSDADLSNAIQQFDSLLAVVRPFFAKNREVLTHDVN
FT                   NLATVTTTLLQPDPLDGLETVLHIFPTLAANINQLYHPTHGGVVSLSAFTNFANPMEFI
FT                   CSSIQAGSRLGYQESAELCAQYLAPVLDAIKFNYFPFGLNVASTASTLPKEIAYSEPRL
FT                   QPPNGYKDTTVPGIWVPDTPLSHRNTQPGWVVAPGMQGVQVGPITQGLLTPESLAELMG
FT                   GPDIAPPSSGLQTPPGPPNAYDEYPVLPPIGLQAPQVPIPPPPPGPDVIPGPVPPTPAP
FT                   VGAPLPAEAGGGQ"
     MSTIFDIRNL RLPQLSRASV VIGSLVVVLA LAAGIVGVRL YQKLTNNTVV AYFTQANALY        60
     VGDKVQIMGL PVGSIDKIEP AGDKMKVTFH YQNKYKVPAN ASAVILNPTL VASRNIQLEP       120
     PYRGGPVLAD NAVIPVERTQ VPTEWDELRD SVSHIIDELG PTPEQPKGPF GEVIEAFADG       180
     LAGKGKQINT TLNSLSQALN ALNEGRGDFF AVVRSLALFV NALHQDDQQF VALNKNLAEF       240
     TDRLTHSDAD LSNAIQQFDS LLAVVRPFFA KNREVLTHDV NNLATVTTTL LQPDPLDGLE       300
     TVLHIFPTLA ANINQLYHPT HGGVVSLSAF TNFANPMEFI CSSIQAGSRL GYQESAELCA       360
     QYLAPVLDAI KFNYFPFGLN VASTASTLPK EIAYSEPRLQ PPNGYKDTTV PGIWVPDTPL       420
     SHRNTQPGWV VAPGMQGVQV GPITQGLLTP ESLAELMGGP DIAPPSSGLQ TPPGPPNAYD       480
     EYPVLPPIGL QAPQVPIPPP PPGPDVIPGP VPPTPAPVGA PLPAEAGGGQ                  530
//

If you have problems or comments...

PBIL Back to PBIL home page