(data stored in ACNUC7421 zone)

EMBL: CP001658.PE184

CP001658.PE184       Location/Qualifiers
FT   CDS             208356..208910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00178"
FT                   /product="MCE-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23205"
FT                   /protein_id="ACT23205.1"
FT                   /translation="MSPRRKFEPGEGALLAPQSIEPSRRWGLPLALTASAVVMAAAISA
FT                   CALMRISHESHQRAAHKDIVMLSDVRSFMTMFTSPDPFHANEYAERVLSHATGDFAKQY
FT                   HERANDILIRISGVEPTTGTVLDAGVQRWNEDGSANVLVVTQITSKSADGKRVVSNANR
FT                   WLVTAKQEGNEWKISSLLPVI"
     MSPRRKFEPG EGALLAPQSI EPSRRWGLPL ALTASAVVMA AAISACALMR ISHESHQRAA        60
     HKDIVMLSDV RSFMTMFTSP DPFHANEYAE RVLSHATGDF AKQYHERAND ILIRISGVEP       120
     TTGTVLDAGV QRWNEDGSAN VLVVTQITSK SADGKRVVSN ANRWLVTAKQ EGNEWKISSL       180
     LPVI                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page