(data stored in ACNUC7421 zone)

EMBL: CP001658.PE185

CP001658.PE185       Location/Qualifiers
FT   CDS             208877..209611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00179"
FT                   /product="MCE-associated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23206"
FT                   /protein_id="ACT23206.1"
FT                   /translation="MEDQQSASGDLTQKSVANGESTDTASAATEGHRGEIDAAGEPDER
FT                   GAAVADSQADEDDSAATAARGGKTRARRSRGRRLAITVGVAAALFVGSAAFAGATVEPY
FT                   LSERAVVATKLMVARTAANAITTLWTYTPENMDTLADRAANYLSGDFAAQYRRFVDQIA
FT                   AANKQAKITNDTEVTGAAVESLSGRDAVAIVYTNTTTTSPVTKNIPALKYLSYRLFMKR
FT                   YDARWLVTRMTTITSLDLTPQV"
     MEDQQSASGD LTQKSVANGE STDTASAATE GHRGEIDAAG EPDERGAAVA DSQADEDDSA        60
     ATAARGGKTR ARRSRGRRLA ITVGVAAALF VGSAAFAGAT VEPYLSERAV VATKLMVART       120
     AANAITTLWT YTPENMDTLA DRAANYLSGD FAAQYRRFVD QIAAANKQAK ITNDTEVTGA       180
     AVESLSGRDA VAIVYTNTTT TSPVTKNIPA LKYLSYRLFM KRYDARWLVT RMTTITSLDL       240
     TPQV                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page